PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_02231A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 310aa    MW: 32499.4 Da    PI: 8.7115
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_02231AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-171461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd+ lv +v+++G+g+W++++   g+ R+ k+c++rw +yl
  Oropetium_20150105_02231A 14 KGPWTPEEDLVLVSYVQEHGPGNWRAVPTNTGLMRCSKSCRLRWTNYL 61
                               79********************************************97 PP

2Myb_DNA-binding49.97.3e-1667112148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                rg+++ +E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Oropetium_20150105_02231A  67 RGNFSDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                                89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.977965IPR017930Myb domain
SuperFamilySSF466896.97E-3011108IPR009057Homeodomain-like
SMARTSM007174.0E-131363IPR001005SANT/Myb domain
PfamPF002493.4E-161461IPR001005SANT/Myb domain
CDDcd001671.11E-111661No hitNo description
Gene3DG3DSA:1.10.10.606.1E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129419.98566116IPR017930Myb domain
SMARTSM007178.9E-1666114IPR001005SANT/Myb domain
PfamPF002491.1E-1467112IPR001005SANT/Myb domain
CDDcd001678.29E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDLVLVSYVQ EHGPGNWRAV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF SDQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLAKLG  120
SNAGEGAAVV IGGGSDAKTT RSATPKGQWE RRLQTDIHTA RQALRDALSL DYSSSSLAPA  180
PPSAATKPEK APVGGQRAAA TYASSAENIA RLLEGWMRPP ATGKTSSGSS ASAVSGDGGA  240
SAASHSGGTA RTPEGSTETS GGKAEDCGAA PPVVPAFSML ESWLLDDGGM GHGETGIMGV  300
PLADPSEFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-26141164105MYB PROTO-ONCOGENE PROTEIN
1mse_C9e-26141164105C-Myb DNA-Binding Domain
1msf_C9e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00395DAPTransfer from AT3G47600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8377781e-135CT837778.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA023K22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648957.11e-138PREDICTED: myb-related protein 306
SwissprotP813921e-107MYB06_ANTMA; Myb-related protein 306
TrEMBLA2YVK11e-139A2YVK1_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA028730-PA1e-139(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.12e-91myb domain protein 30